Loading...
Statistics
Advertisement

Home - School Self-Evaluation
www.schoolself-evaluation.ie/

Schoolself-evaluation.ie

Advertisement
Schoolself-evaluation.ie is hosted in Ireland . Schoolself-evaluation.ie uses HTTPS protocol. Number of used technologies: 8. First technologies: CSS, Html, Html5, Number of used javascripts: 9. First javascripts: Jquery.js, Jquery-migrate.min.js, Jquery.form.min.js, Number of used analytics tools: 0. Number of used plugins, modules: 1. Its server type is: Apache. Its CMS is: Wordpress.

Technologies in use by Schoolself-evaluation.ie

Technology

Number of occurences: 8
  • CSS
  • Html
  • Html5
  • Javascript
  • jQuery
  • Php
  • Pingback
  • SVG

Advertisement

Javascripts

Number of occurences: 9
  • jquery.js
  • jquery-migrate.min.js
  • jquery.form.min.js
  • scripts.js
  • navigation.js
  • skip-link-focus-fix.js
  • bundle.js
  • widgets.js
  • wp-embed.min.js

Content Management System

Number of occurences: 1
  • Wordpress

Server Type

  • Apache

Powered by

  • PHP/5.6.23

Social

Number of occurences: 1
  • Twitter Button

Used plugins, modules

Number of plugins and modules: 1
  • contact form 7

Conversion rate optimization

visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Schoolself-evaluation.ie

SSL certificate

    • name: /C=RU/ST=Moscow/L=Moscow/O=Parallels/OU=Parallels Automation/CN=parallels.com/emailAddress=webmaster@parallels.com
    • subject:
      • C: RU
      • ST: Moscow
      • L: Moscow
      • O: Parallels
      • OU: Parallels Automation
      • CN: parallels.com
      • emailAddress: webmaster@parallels.com
    • hash: d9542de8
    • issuer:
      • C: RU
      • ST: Moscow
      • L: Moscow
      • O: Parallels
      • OU: Parallels Automation
      • CN: parallels.com
      • emailAddress: webmaster@parallels.com
    • version: 3
    • serialNumber: 1361552549
    • validFrom: 701231210000Z
    • validTo: 371231200000Z
    • validFrom_time_t: 31525200
    • validTo_time_t: 2145902400
    • extensions:

    Meta - Schoolself-evaluation.ie

    Number of occurences: 6
    • Name:
      Content: School Self-Evaluation
    • Name: viewport
      Content: width=device-width, initial-scale=1
    • Name: twitter:card
      Content: summary
    • Name: twitter:description
      Content: Welcome to the School Self-Evaluation website School self-evaluation is a collaborative, inclusive, reflective process of internal school review. It is an evidence-based approach which involves gathering information from a range of sources and making judgements with a view to bringing about improvements in students’ learning. This site is hosted by the Inspectorate of the Department […]
    • Name: twitter:title
      Content: Home - School Self-Evaluation
    • Name: generator
      Content: qTranslate-X 3.4.6.8

    Server / Hosting

    • IP: 78.153.220.4
    • Latitude: 53.35
    • Longitude: -6.24
    • Country: Ireland

    Rname

    • ns1.blacknight.com
    • ns2.blacknight.com
    • smtp1r.cp.blacknight.com

    Target

    • bec.blackrockec.ie

    HTTP Header Response

    HTTP/1.1 301 Moved Permanently Date: Sun, 04 Sep 2016 23:59:43 GMT Server: Apache X-Powered-By: PHP/5.6.23 Set-Cookie: qtrans_front_language=en; expires=Mon, 04-Sep-2017 23:59:43 GMT; Max-Age=31536000; path=/ X-SERVER: 3019 Location: http://schoolself-evaluation.ie/ Content-Length: 0 Content-Type: text/html; charset=UTF-8 X-Cache: MISS from s_wx1011 X-Cache-Lookup: MISS from s_wx1011:80 Via: 1.1 s_wx1011 (squid/3.5.20) Connection: keep-alive HTTP/1.1 200 OK Date: Sun, 04 Sep 2016 23:59:44 GMT Server: Apache X-Powered-By: PHP/5.6.23 Link: ; rel="https://api.w.org/", ; rel=shortlink Set-Cookie: qtrans_front_language=en; expires=Mon, 04-Sep-2017 23:59:44 GMT; Max-Age=31536000; path=/ X-SERVER: 3019 Content-Type: text/html; charset=UTF-8 X-Cache: MISS from s_wx1011 X-Cache-Lookup: MISS from s_wx1011:80 Transfer-Encoding: chunked Via: 1.1 s_wx1011 (squid/3.5.20) Connection: keep-alive

    DNS

    host: schoolself-evaluation.ie
    1. class: IN
    2. ttl: 3600
    3. type: A
    4. ip: 78.153.220.4
    host: schoolself-evaluation.ie
    1. class: IN
    2. ttl: 3600
    3. type: NS
    4. target: ns1.blacknight.com
    host: schoolself-evaluation.ie
    1. class: IN
    2. ttl: 3600
    3. type: NS
    4. target: ns2.blacknight.com
    host: schoolself-evaluation.ie
    1. class: IN
    2. ttl: 3600
    3. type: SOA
    4. mname: ns1.blacknight.com
    5. rname: bec.blackrockec.ie
    6. serial: 1268520333
    7. refresh: 14400
    8. retry: 7200
    9. expire: 2419200
    10. minimum-ttl: 3600
    host: schoolself-evaluation.ie
    1. class: IN
    2. ttl: 3600
    3. type: MX
    4. pri: 10
    5. target: smtp1r.cp.blacknight.com
    host: schoolself-evaluation.ie
    1. class: IN
    2. ttl: 3600
    3. type: TXT
    4. txt: v=spf1 a include:spf.blacknight.ie ~all
    5. entries: Array
    host: schoolself-evaluation.ie
    1. class: IN
    2. ttl: 3600
    3. type: AAAA
    4. ipv6: 2a01:a8:dc0:332::169

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.choolself-evaluation.ie, www.sechoolself-evaluation.ie, www.echoolself-evaluation.ie, www.swchoolself-evaluation.ie, www.wchoolself-evaluation.ie, www.sdchoolself-evaluation.ie, www.dchoolself-evaluation.ie, www.sxchoolself-evaluation.ie, www.xchoolself-evaluation.ie, www.sfchoolself-evaluation.ie, www.fchoolself-evaluation.ie, www.sgchoolself-evaluation.ie, www.gchoolself-evaluation.ie, www.stchoolself-evaluation.ie, www.tchoolself-evaluation.ie, www.shoolself-evaluation.ie, www.scdhoolself-evaluation.ie, www.sdhoolself-evaluation.ie, www.scrhoolself-evaluation.ie, www.srhoolself-evaluation.ie, www.scthoolself-evaluation.ie, www.sthoolself-evaluation.ie, www.scvhoolself-evaluation.ie, www.svhoolself-evaluation.ie, www.scfhoolself-evaluation.ie, www.sfhoolself-evaluation.ie, www.scghoolself-evaluation.ie, www.sghoolself-evaluation.ie, www.schhoolself-evaluation.ie, www.shhoolself-evaluation.ie, www.scnhoolself-evaluation.ie, www.snhoolself-evaluation.ie, www.scmhoolself-evaluation.ie, www.smhoolself-evaluation.ie, www.scjhoolself-evaluation.ie, www.sjhoolself-evaluation.ie, www.scoolself-evaluation.ie, www.scheoolself-evaluation.ie, www.sceoolself-evaluation.ie, www.schdoolself-evaluation.ie, www.scdoolself-evaluation.ie, www.schcoolself-evaluation.ie, www.sccoolself-evaluation.ie, www.schuoolself-evaluation.ie, www.scuoolself-evaluation.ie, www.schjoolself-evaluation.ie, www.scjoolself-evaluation.ie, www.schoolself-evaluation.ie, www.scoolself-evaluation.ie, www.schboolself-evaluation.ie, www.scboolself-evaluation.ie, www.schgoolself-evaluation.ie, www.scgoolself-evaluation.ie, www.scholself-evaluation.ie, www.schobolself-evaluation.ie, www.schbolself-evaluation.ie, www.schoholself-evaluation.ie, www.schholself-evaluation.ie, www.schogolself-evaluation.ie, www.schgolself-evaluation.ie, www.schojolself-evaluation.ie, www.schjolself-evaluation.ie, www.schomolself-evaluation.ie, www.schmolself-evaluation.ie, www.scho olself-evaluation.ie, www.sch olself-evaluation.ie, www.schovolself-evaluation.ie, www.schvolself-evaluation.ie, www.scholself-evaluation.ie, www.schooblself-evaluation.ie, www.schoblself-evaluation.ie, www.schoohlself-evaluation.ie, www.schohlself-evaluation.ie, www.schooglself-evaluation.ie, www.schoglself-evaluation.ie, www.schoojlself-evaluation.ie, www.schojlself-evaluation.ie, www.schoomlself-evaluation.ie, www.schomlself-evaluation.ie, www.schoo lself-evaluation.ie, www.scho lself-evaluation.ie, www.schoovlself-evaluation.ie, www.schovlself-evaluation.ie, www.schooself-evaluation.ie, www.schooluself-evaluation.ie, www.schoouself-evaluation.ie, www.school8self-evaluation.ie, www.schoo8self-evaluation.ie, www.school9self-evaluation.ie, www.schoo9self-evaluation.ie, www.schooljself-evaluation.ie, www.schoojself-evaluation.ie, www.school0self-evaluation.ie, www.schoo0self-evaluation.ie, www.schoolmself-evaluation.ie, www.schoomself-evaluation.ie, www.schoolpself-evaluation.ie, www.schoopself-evaluation.ie, www.schooloself-evaluation.ie, www.schoooself-evaluation.ie, www.schoolelf-evaluation.ie, www.schoolseelf-evaluation.ie, www.schooleelf-evaluation.ie, www.schoolswelf-evaluation.ie, www.schoolwelf-evaluation.ie, www.schoolsdelf-evaluation.ie, www.schooldelf-evaluation.ie, www.schoolsxelf-evaluation.ie, www.schoolxelf-evaluation.ie, www.schoolsfelf-evaluation.ie, www.schoolfelf-evaluation.ie, www.schoolsgelf-evaluation.ie, www.schoolgelf-evaluation.ie, www.schoolstelf-evaluation.ie, www.schooltelf-evaluation.ie, www.schoolslf-evaluation.ie, www.schoolsxlf-evaluation.ie, www.schoolseslf-evaluation.ie, www.schoolsslf-evaluation.ie, www.schoolsewlf-evaluation.ie, www.schoolswlf-evaluation.ie, www.schoolserlf-evaluation.ie, www.schoolsrlf-evaluation.ie, www.schoolseflf-evaluation.ie, www.schoolsflf-evaluation.ie, www.schoolsevlf-evaluation.ie, www.schoolsvlf-evaluation.ie, www.schoolseclf-evaluation.ie, www.schoolsclf-evaluation.ie, www.schoolseqlf-evaluation.ie, www.schoolsqlf-evaluation.ie, www.schoolsealf-evaluation.ie, www.schoolsalf-evaluation.ie, www.schoolseylf-evaluation.ie, www.schoolsylf-evaluation.ie, www.schoolsef-evaluation.ie, www.schoolseluf-evaluation.ie, www.schoolseuf-evaluation.ie, www.schoolsel8f-evaluation.ie, www.schoolse8f-evaluation.ie, www.schoolsel9f-evaluation.ie, www.schoolse9f-evaluation.ie, www.schoolseljf-evaluation.ie, www.schoolsejf-evaluation.ie, www.schoolsel0f-evaluation.ie, www.schoolse0f-evaluation.ie, www.schoolselmf-evaluation.ie, www.schoolsemf-evaluation.ie, www.schoolselpf-evaluation.ie, www.schoolsepf-evaluation.ie, www.schoolselof-evaluation.ie, www.schoolseof-evaluation.ie, www.schoolsel-evaluation.ie, www.schoolselfq-evaluation.ie, www.schoolselq-evaluation.ie, www.schoolself-evaluation.ie, www.schoolsel-evaluation.ie, www.schoolselfa-evaluation.ie, www.schoolsela-evaluation.ie, www.schoolselfy-evaluation.ie, www.schoolsely-evaluation.ie, www.schoolselft-evaluation.ie, www.schoolselt-evaluation.ie, www.schoolselfg-evaluation.ie, www.schoolselg-evaluation.ie, www.schoolselfb-evaluation.ie, www.schoolselb-evaluation.ie, www.schoolselfw-evaluation.ie, www.schoolselw-evaluation.ie, www.schoolselfs-evaluation.ie, www.schoolsels-evaluation.ie, www.schoolselfd-evaluation.ie, www.schoolseld-evaluation.ie, www.schoolselfr-evaluation.ie, www.schoolselr-evaluation.ie, www.schoolself3-evaluation.ie, www.schoolsel3-evaluation.ie, www.schoolself4-evaluation.ie, www.schoolsel4-evaluation.ie,

    Other websites we recently analyzed

    1. Ãœber uns | cairos-academy
      Germany - 78.47.220.105
      Server software: Apache
      Technology: CSS, Html
      Number of meta tags: 1
    2. miscmannamagalginknimatnyasvetchargapoleaz
      San Francisco (United States) - 192.0.78.13
      Server software: nginx
      Technology: Skimlinks, CSS, Gravatar, Html, Html5, Javascript, Php, Pingback, Shortcodes, comScore, Wordpress, Twitter Button
      Number of Javascript: 8
      Number of meta tags: 7
    3. ¿Ã‹Ã‚¡ÍõվȺ ÁªÏµQQ£º1785605588
      Kansas City (United States) - 173.208.215.148
      Server software: Microsoft-IIS/6.0
      Technology: Html
      Number of meta tags: 1
    4. Restaurant La Ripaille
      Le restaurant La Ripaille est situé à Arromanches, nous vous proposons une cuisine Normande traditionnelle.
      France - 213.186.33.104
      G Analytics ID: UA-441859-8
      Server software: Apache
      Technology: Carousel, CSS, Html, Html5, Iframe, Javascript, Google Analytics
      Number of Javascript: 2
      Number of meta tags: 4
    5. Tennessee Career Centers
      Columbia (United States) - 66.211.30.3
      G Analytics ID: UA-39861102-1
      Server software:
      Technology: CSS, Html, Iframe, Javascript, Php, Swf Object, Google Analytics, Facebook Like box
      Number of Javascript: 4
      Number of meta tags: 1
    6. Home | Instant Spark
      Scottsdale (United States) - 173.201.243.1
      Server software: Apache
      Technology: Html
    7. Die Potsdam Lions
      Germany - 212.90.148.98
      Server software: Apache/2.2.31
      Technology: Html, Php
      Number of meta tags: 1
    8. Dorcas Clothing :: Wholesale Clothing
      Dorcas is a fashion wholesaler specializing in women's apparel located in Los Angeles fashion district. We offer the latest fashion at the best quality and price.
      Montréal (Canada) - 184.107.203.99
      Server software: Apache
      Technology: CSS, Html, Javascript, jQuery Cycle, jQuery UI, Lightbox, Php
      Number of Javascript: 10
      Number of meta tags: 10
    9. THE NEW MILLIONS
      New York (United States) - 198.185.159.145
      Server software:
      Technology: CSS, Html, Iframe, Javascript, Lightbox, Php, Squarespace
      Number of Javascript: 2
      Number of meta tags: 7
    10. ماشین های اداری امیران
      امیران ماشین
      Iran, Islamic Republic of - 185.8.172.176
      Server software: Apache
      Technology: CSS, Font Awesome, Html, Html5, Javascript, Php, SVG
      Number of Javascript: 4
      Number of meta tags: 3

    Check Other Websites